Activities | Families | Sequences | Fold types | References | Help
B6db sequences: bab80047.1

BAB80047.1

Description hypothetical protein [Clostridium perfringens str. 13]
Activity 4.1.1.12
Family 4.1.1.12
Evidence ISS - similarity
Phylum Bacteria
OS Clostridium perfringens str. 13
GB BAB80047.1
SQ
MITKDLEKKLEGLGAFEISSKMLKLAKNNEKHNKFLNAGRGNPNWINTEGRLALGRIVEF
GVFESRRTIHEGNLAGYTNLDGIYERLMDFLNGGHEVDKFLRDAIDYSIKTLSVNKDELV
KEFVDGAIGNDYPVPNRCLVNTEKILKLYLEKELFGGVKLAKETNVFPTEGGTAAICYIF
NSLKENGLIKAGDKIAINTPIFTPYLQIPELKDYEMVEVDLISKEENNWVIEDSELDKLR
DKEIKALFFVNPSNPASKALSEEALNHIADIVKERKDLMIITDDVYGTFVENFKTIYSVA
PHNTLLVYSFSKLYGVTGWRLGLIAANENNVFDELISKLPEEKLQDLDKRYGLVTFEPRK
FKFIERIVADSRSVGLYHTSGLSTPQQIQMALFALTSLITKGRDPYIESSKNLVRERYHD
LCNTLGIKEDDSRENAKYYSLIDIYELAGDLYDHKFKEYLKENFEPIDFLLRLAEINGVV
LMEGVGFGAAPGILRVSEANLPDEAYKKIAKQVLELLSEYYNQYKSQN
 
last changed 2005/03/16 20:04

B6db sequences