Activities | Families | Sequences | Fold types | References | Help
B6db sequences: bac07960

BAC07960

Description omega-amino acid:pyruvate aminotransferase [Thermosynechococcus elongatus BP-1]
Activity 2.6.1.18
Family 2.6.1.18
Evidence ISS - similarity
Phylum Bacteria
OS Thermosynechococcus elongatus BP-1
GB BAC07960
SQ
MSLWRPTAILLASDLPLIPPTRLRAMTLPTFVDLNLDPFWMPFTANRQFKQSPRLLVSAA
GMYYRSIDGREILDGTAGLWCVNAGHCRPEIISAIAQQAATLDFAPTFQMGHPGPFQVAD
RLRRITPDPLNHVFFANSGSEAVDTALKIALAYHRLRGEGTRQRLIGRERGYHGVGFGGI
SVGGIAPNRKFFGSLLAGVDHLPHTHNLEHNAFSKGQPTWGAHLADELERLVALHDASTI
AAVIVEPLAGSTGVLIPPQGYLERLRAICDRYGILLIFDEVITGFGRLGAPFASQYFGVT
PDLITVAKGLTNAAVPMGAVIVRDEIYETFMQGPAGQIEFFHGYTYSGHPLACAAALATL
EIYEKEALFERAASLAPYWQEAIHSLRGLPHVIDIRNLGLVAGIELAPREGQGGPRGYDA
LCRAFEAGLLIRVTGDIIALSPPLIVERSHIDQMVDILSRVLQELP
 
last changed 2010/01/08 13:07

B6db sequences