Activities | Families | Sequences | Fold types | References | Help
B6db sequences: bai02483

BAI02483

Description purine catabolism protein PucG
Activity pucg
Family pucg
Evidence ISS - similarity
Phylum Bacteria
OS Acetobacter pasteurianus
GB BAI02483
SQ
MEQTRMISPMFKQIDPPQRFLMGPGPINAHPRVLRAMSADMLGQFDPEMTEYMNETMALY
RQVFMTENQWTFLVDGTARAGIEAALVSLVEPGAKILIVRAGRFGLLLSEIAERIGAEIC
TLDLPWGEVASLEQIEAALQEHKPQVLACIHGDTSTTMAQPLDGVGALCKKYNVLSYVDV
TATLGGVPVCTDQWGIDVISGGLQKCMGGPPGSAPITISDRAAEHIMARRHVEAGIRSAS
LTDGQRPRIPSNYFDLAMVMDYWSEKRLNHHTEATTMLYGAREAACIVLEEGLENRFARH
KTASTALIAGLRAMGLTIFGDDAHRMANVTGVWIPASVDGDKVRMRMRDDFGIEIGTAFG
PLTGKIWRIGTMGYNAVKHKVLLTLGALEAALAAEGFKPPRGAAVDAAMASWP
 
last changed 2010/06/17 13:11

B6db sequences