Activities | Families | Sequences | Fold types | References | Help
B6db sequences: bal72830

BAL72830

Description aromatic L-amino acid decarboxylase
Activity 4.1.1.28
Family 4.1.1.28
Evidence IDA - direct assay
Phylum Viridiplantae
OS Rosa hybrid cultivar
GB BAL72830
SQ
MGSFPFHQDLQEIASSQLTKALDPEEFRKQGHMVIDFIADYYQNIEKYPVLSRVEPGYLK
KCLPESAPYDPEPISTILKDVQDHIVPGLTHWQSPNFFAYFSSTASTAGFLGEILTTGFN
VVGFNWVSSPAATELENIVMDWLGDMLQLPKSFHFSGNGGGVLHGSTCEAIVCTMVAARD
QMLRRIGSENLGKLVVYGSDQTHSTLQKATQIVGINTENFRAIKTTKSTGFALSPEMLRL
TISSDLEKGLVPLFLCATIGTTATTAIDPLEALCHVAKEYGVWVHVDAAYAGSACICPEF
RHFINGVEGANSFSFNPHKWLFTGMDCCCLWVKNPSVLASSLSTNPEFLRNKASDSKQVV
DYKDWQIALSRRFRALKLWLVLRSYGVANLRNFIRIHVNMAKTFEGLVRMDKRFEILVPR
NFSLVCFRISPSALISSNEDDEIGMVNEVNCKLLEAINASGKAYMTHAVVGGLYVLRCAV
GATLSEEKHIVEAWKVVQDHAKAILSTYW
 
last changed 2014/02/26 12:14

B6db sequences