Activities | Families | Sequences | Fold types | References | Help
B6db sequences: bca1.arath

BCA1_ARATH

Description Branched-chain amino acid aminotransferase 1, mitochondrial precursor (Atbcat-1)
Activity 2.6.1.42
Family 2.6.1.42
Evidence IGI - genetic interaction
Phylum Viridiplantae
OS Arabidopsis thaliana
GB BCA1_ARATH
SQ
MALRRCLPQYSTTSSYLSKIWGFRMHGTKAAASVVEEHVSGAEREDEEYADVDWDNLGFS
LVRTDFMFATKSCRDGNFEQGYLSRYGNIELNPAAGILNYGQGLIEGMKAYRGEDGRVLL
FRPELNAMRMKIGAERMCMHSPSVHQFIEGVKQTVLANRRWVPPPGKGSLYLRPLLFGSG
ASLGVAAASEYTFLVFGSPVQNYFKEGTAALNLYVEEVIPRAYLGGTGGVKAISNYGPVL
EVMRRAKSRGFSDVLYLDADTGKNIEEVSAANIFLVKGNTIVTPATSGTILGGITRKSII
EIALDLGYKVEERSVPVEELKEAEEVFCTGTAAGVASVGSITFKNTRTEYKVGDGIVTQQ
LRSILVGIQTGSIQDTKDWVLQIA
 
last changed 2005/03/16 20:04

B6db sequences