Activities | Families | Sequences | Fold types | References | Help
B6db sequences: bca1.schpo

BCA1_SCHPO

Description Branched-chain amino acid aminotransferase, mitochondrial precursor
Activity 2.6.1.42
Family 2.6.1.42
Evidence IDA - direct assay
Phylum Fungi
OS Schizosaccharomyces pombe
GB BCA1_SCHPO
SQ
MVQTAALHGPKPMDSSHIKVTNVKELKPLPEWKSLKFGENFTDHMLIMKWNREKGWSTPE
IVPFGKLCFHPASSVFHYGFECFEGMKAFRDEKGVPRLFRPIKNAERMLSTGTRISLPSF
DPAELAEIIRKFVAHENRWVPDQRGYSLYIRPTFIGTDEALGVHHCDNAMLYVIASPVGP
YYSSGFKAVKLCCSEESVRAWPGGTGHYKLGGNYAPSVLPQKEAAKKGYAQILWLYGDED
YITEVGTMNCFTVWINKNGEKEIITAPLDGMILPGVTRDSILEICRERLAPKGWKITEGK
YSMKEVAQASKEGRLLEVFGAGTAALVSPVKAINYKGTEYEIPMPEGQEAGPITSEISKW
ILDIQYGKEPNNPWSVPALP
 
last changed 2005/03/16 20:05

B6db sequences