Activities | Families | Sequences | Fold types | References | Help
B6db sequences: bca1.yeast

BCA1_YEAST

Description Branched-chain amino acid aminotransferase, mitochondrial precursor
Activity 2.6.1.42
Family 2.6.1.42
Evidence IGI - genetic interaction
Phylum Fungi
OS Saccharomyces cerevisiae
GB BCA1_YEAST
SQ
MLQRHSLKLGKFSIRTLATGAPLDASKLKITRNPNPSKPRPNEELVFGQTFTDHMLTIPW
SAKEGWGTPHIKPYGNLSLDPSACVFHYAFELFEGLKAYRTPQNTITMFRPDKNMARMNK
SAARICLPTFESEELIKLTGKLIEQDKHLVPQGNGYSLYIRPTMIGTSKGLGVGTPSEAL
LYVITSPVGPYYKTGFKAVRLEATDYATRAWPGGVGDKKLGANYAPCILPQLQAAKRGYQ
QNLWLFGPEKNITEVGTMNVFFVFLNKVTGKKELVTAPLDGTILEGVTRDSVLTLARDKL
DPQEWDINERYYTITEVATRAKQGELLEAFGSGTAAVVSPIKEIGWNNEDIHVPLLPGEQ
CGALTKQVAQWIADIQYGRVNYGNWSKTVADLN
 
last changed 2005/03/16 20:04

B6db sequences