Activities | Families | Sequences | Fold types | References | Help
B6db sequences: bca2.yeast

BCA2_YEAST

Description Branched-chain amino acid aminotransferase, cytosolic (EC 2.6.1.42)
Activity 2.6.1.42
Family 2.6.1.42
Evidence IGI - genetic interaction
Phylum Fungi
OS Saccharomyces cerevisiae
GB BCA2_YEAST
SQ
MTLAPLDASKVKITTTQHASKPKPNSELVFGKSFTDHMLTAEWTAEKGWGTPEIKPYQNL
SLDPSAVVFHYAFELFEGMKAYRTVDNKITMFRPDMNMKRMNKSAQRICLPTFDPEELIT
LIGKLIQQDKCLVPEGKGYSLYIRPTLIGTTAGLGVSTPDRALLYVICCPVGPYYKTGFK
AVRLEATDYATRAWPGGCGDKKLGANYAPCVLPQLQAASRGYQQNLWLFGPNNNITEVGT
MNAFFVFKDSKTGKKELVTAPLDGTILEGVTRDSILNLAKERLEPSEWTISERYFTIGEV
TERSKNGELLEAFGSGTAAIVSPIKEIGWKGEQINIPLLPGEQTGPLAKEVAQWINGIQY
GETEHGNWSRVVTDLN
 
last changed 2005/03/16 20:04

B6db sequences