Activities | Families | Sequences | Fold types | References | Help
B6db sequences: bca5.arath

BCA5_ARATH

Description Branched-chain amino acid aminotransferase 5, chloroplast precursor (Atbcat-5)
Activity 2.6.1.42
Family 2.6.1.42
Evidence IGI - genetic interaction
Phylum Viridiplantae
OS Arabidopsis thaliana
GB BCA5_ARATH
SQ
MERSAVASGFHRNYILCASRAATSTTRLHSLSSLRNFPSSSLRIRHCPSPISSNFIVSEV
SRNRRCDAVSSSTTDVTELAEIDWDKIDFGLKPTDYMYAMKCSRDGEFSQGQLQPFGNID
INPAAGVLNYGQGLFEGLKAYRKQDGNILLFRPEENAIRMRNGAERMCMPSPTVEQFVEA
VKTTVLANKRWIPPPGKGSLYIRPLLMGTGAVLGLAPAPEYTFLIFVSPVGNYFKEGVAP
INLIVETEFHRATPGGTGGVKTIGNYAAVLKAQSIAKAKGYSDVLYLDCLHKRYLEEVSS
CNIFIVKDNVISTPEIKGTILPGITRKSIIEVARSQGFKVEERNVTVDELVEADEVFCTG
TAVVLSPVGSITYKSQRFSYGEDGFGTVSKQLYTSLTSLQMGLSEDNMNWTVQLS
 
last changed 2005/03/16 20:05

B6db sequences