Activities | Families | Sequences | Fold types | References | Help
B6db sequences: bcam.human

BCAM_HUMAN

Description Branched-chain amino acid aminotransferase, mitochondrial precursor
Activity 2.6.1.42
Family 2.6.1.42
Evidence IDA - direct assay
Phylum Metazoa
OS Homo sapiens
GB BCAM_HUMAN
SQ
MAAAALGQIWARKLLSVPWLLCGPRRYASSSFKAADLQLEMTQKPHKKPGPGEPLVFGKT
FTDHMLMVEWNDKGWGQPRIQPFQNLTLHPASSSLHYSLQLFEGMKAFKGKDQQVRLFRP
WLNMDRMLRSAMRLCLPSFDKLELLECIRRLIEVDKDWVPDAAGTSLYVRPVLIGNEPSL
GVSQPRRALLFVILCPVGAYFPGGSVTPVSLLADPAFIRAWVGGVGNYKLGGNYGPTVLV
QQEALKRGCEQVLWLYGPDHQLTEVGTMNIFVYWTHEDGVLELVTPPLNGVILPGVVRQS
LLDMAQTWGEFRVVERTITMKQLLRALEEGRVREVFGSGTACQVCPVHRILYKDRNLHIP
TMENGPELILRFQKELKEIQYGIRAHEWMFPV
 
last changed 2005/03/16 20:05

B6db sequences