Activities | Families | Sequences | Fold types | References | Help
B6db sequences: bcam.rat

BCAM_RAT

Description Branched-chain amino acid aminotransferase, mitochondrial precursor
Activity 2.6.1.42
Family 2.6.1.42
Evidence ISS - similarity
Phylum Metazoa
OS Rattus norvegicus
GB BCAM_RAT
SQ
MSAAILGQVWTRKLLPIPWRLCVPGRCVSSNFKAADLQVQVTREPQKKPAPSQPLLFGKT
FTDHMLMVEWNSKTGWGPPRIQPFQNLTLHPACSGLHYSLQLFEGLKAYKGRDKQVRLFR
PWLNMDRMLRSARRLCLPDFDKQELLECIRQLIEVDKDWVPDGNGTSLYVRPVLIGNEPS
LGVGMVTQALLFVILCPVGSYFPGDSMTPVSLLADPSFVRAWIGGVGDCKLGGNYGPTVA
VQQEAQKKGCEQVLWLYGPDHQLTEVGTMNIFVYWTHEDGELELATPPLDGIILPGVVRQ
SLLDLARTWGEFRVAERKVTMKELKRALEEGRVREVFGSGTACQVCPVHQILYEGKQLHI
PTMENGPELILRFQKELKAIQYGTSAHDWMLRV
 
last changed 2005/03/16 20:05

B6db sequences