Activities | Families | Sequences | Fold types | References | Help
B6db sequences: bcat.caeel

BCAT_CAEEL

Description Branched-chain amino acid aminotransferase, cytosolic (EC 2.6.1.42)
Activity 2.6.1.42
Family 2.6.1.42
Evidence ISS - similarity
Phylum Metazoa
OS Caenorhabditis elegans
GB BCAT_CAEEL
SQ
MPAILSRVAPRTFNLVGSRLMASAARLETVPREEIHKEYDRKKTFYHRDLEIQLAGPTQL
KTKPLDPTKLKFGHTYADYMMTCDWDAERGWHHPKIEPIGELKIHPGAKVLHYASELFEG
MKAYRGIDNKIRMFRPEMNMARMKRTALRAALPDFDSEEMINVLTELLRLDQEWVPNSDV
CSLYLRPTLIGTDPTLGVGCATEAKMFVITGPVGAYYSTGFQPVSLLADSRFIRAFPGGV
GAYKMGCNYAPTIWVGKEAASKNCQQVLWLYGENEDLTEVGTMNIFLFWKNEEGDMELIT
PPLHRGLILPGVTRDSLLELGREWGEYKVTERTLNMEEVKKALSEKRLYEMFGSGTACVV
SPVGKILYHNKVTDEYEELHIPTMSSKFGVMQKFYNTINDIQYGRIIKDGWMRDI
 
last changed 2005/03/16 20:05

B6db sequences