Activities | Families | Sequences | Fold types | References | Help
B6db sequences: bcat.rat

BCAT_RAT

Description Branched-chain amino acid aminotransferase, cytosolic (EC 2.6.1.42)
Activity 2.6.1.42
Family 2.6.1.42
Evidence IDA - direct assay
Phylum Metazoa
OS Rattus norvegicus
GB BCAT_RAT
SQ
MAYLSRATATLARQDCSNGCSASYAEEEELEASTESYDEEGGSEASTQTFRAKDLIITKA
DVLKKKPDPSSLVFGASFTDHMLMVEWTSKYGWDKPHIKPFENLSIHPAASVLHYAVELF
EGLKAFRGVDNKIRLFRPDLNMKRMCRSAVRTTLPEFDKEELLQCVLQLIQLDREWVPYS
TSASLYIRPTFIGIEPSLGVKKPSKALLFVILSPVGSYFSNGTFSPVSLWANPKFVRSWK
GGTGDFKMGCNYGSSLLAQCEAAENGCHQVLWLYGKENRITEVGTMNLFLYWINKDGEEE
LATPPLDGVILPGVTRQSILELGEEWGEFKVCERHITMDDLSTALEENRVKEMFGSGTAC
VVCPVASILYKGQMLHIPTMENGHKLSSRIMAKLTDIQYGRIKSEWTLELP
 
last changed 2005/03/16 20:04

B6db sequences