Activities | Families | Sequences | Fold types | References | Help
B6db sequences: cac46058.1

CAC46058.1

Description PROBABLE CYSTATHIONINE BETA-LYASE PROTEIN [Sinorhizobium meliloti]
Activity 4.4.1.8
Family 4.4.1.8.a
Evidence ISS - similarity
Phylum Bacteria
OS Sinorhizobium meliloti
GB CAC46058.1
SQ
MADNKIGKAEQGINTRLAHTGNNPSDFHGFVNPPVVHASTVLFPNARTMETRAQKYTYGT
RGTPTTDALCEAVNELEGAAGTILVPSGLAAVTVPFLAYLSSGDHVLIVDSVYFPTRHFC
DTMLSRLGVTVEYYDPTIGAGIENLIRPNTRLVHTEAPGSNTFEMQDIPAIAAAAHRHGC
IVTMDNTWATPVYFRPLDHGVDVSIHAATKYPSGHSDVLLGTVSANAAHWPALSEAMVTL
GVSVSPDDSYQILRGLRTMGVRLVRHQASALAIAEWLEGRDEVARVLHPALPSFPGHELW
KRDFGGASGIFSFVLKAEPEDGKAKAHAFLDALSLFGLGYSWGGFESLAVHVNLSDRKVA
KAPSEGPVIRLQIGLEDVPDIRRDIEAGLAAANAV
 
last changed 2005/03/16 20:05

B6db sequences