Activities | Families | Sequences | Fold types | References | Help
B6db sequences: cad14712.1

CAD14712.1

Description PROBABLE AROMATIC-AMINO-ACID AMINOTRANSFERASE PROTEIN [Ralstonia solanacearum]
Activity 2.6.1.57
Family 2.6.1.57.a
Evidence ISS - similarity
Phylum Bacteria
OS Ralstonia solanacearum
GB CAD14712.1
SQ
MSLFSAVELAPRDPILGLNEAFNADARSTKVNLGVGVYFTDEGKIPVLRAVQEAEKARLA
MAAPRGYLPIEGIAAYDQAVQKLLFGADSPLLAEGRVVTAQALGGTGALKIGADFLKRLY
PDAKVAISDPSWENHRALFEAAGFPVVNYPYYDAPTHGLNFAAMLEALNGYAPNTIVVLH
ACCHNPTGVDLTTEQWKQVVEVIKAKQLIPFLDMAYQGFADGIAQDGLAVSLFAESGLQF
FVSSSFSKSFSLYGERVGALSIVTTSKDEAARVMSQVKRVIRTNYSNPPTHGGTVVASVL
TSPELRAMWEQELGEMRDRIKSMRHALVDKLAAKGVKTDFSFVKAQRGMFSYSGLSAAQV
DRLRNEHGIYAVSTGRICVAALNSHNIDAVVNAIAEVL
 
last changed 2005/03/16 20:05

B6db sequences