Activities | Families | Sequences | Fold types | References | Help
B6db sequences: cad15341.1

CAD15341.1

Description PUTATIVE CYSTATHIONINE BETA-LYASE (CYSTEINE LYASE) PROTEIN [Ralstonia solanacearum]
Activity 4.4.1.8
Family 4.4.1.8.a
Evidence ISS - similarity
Phylum Bacteria
OS Ralstonia solanacearum
GB CAD15341.1
SQ
MTDETKLPPPFPATQAVHPDLHIPPGFAAFSHATHRASTVVFKNLADMRAFGHGSVVHWR
YGLHATPTSDTLCQALAQIEGGRHALLLPSGLGAISLVYFALVKSGDDVLIPDNAYGPTR
DHGEWMARQFGITVRYYDPMIGAGIAGLIRHNTRLVWLEAPGSVTMEVPDCTAIAEAARA
AGAITAIDNTWSGGLYYQPFAHGIDISVQALTKYQSGGSDVLMGATITNDEALYHTLLST
RMRMGWGVSADDCFLVLRGLPSLPARLAAHDAHAREVAEWLAERPEVVRVLHPALPDCPG
HAYWKRDFTGASGLFSIVLHTRYAPAQIDAFVEALRYFAIGFSWGGANSLALPYSVPSMR
TATVWPPAGWESAGGLVRLYIGLEDPRDLIADLKKAMEAHLRAA
 
last changed 2005/03/16 20:05

B6db sequences