Activities | Families | Sequences | Fold types | References | Help
B6db sequences: cad17797.1

CAD17797.1

Description PROBABLE 1-AMINOCYCLOPROPANE-1-CARBOXYLATE DEAMINASE (ACC DEAMINASE) PROTEIN [Ralstonia solanacearum]
Activity 3.5.99.7
Family 3.5.99.7
Evidence ISS - similarity
Phylum Bacteria
OS Ralstonia solanacearum
GB CAD17797.1
SQ
MNLNKHPRHPLTFGPTPIQPLKRLSAHLGGKVELYAKREDCNSGLAFGGNKTRKLEYLVP
EVLAGGYDTLVSIGGIQSNQTRQVAAVAAHLGLKCVLVQENWVNYADAVYDRVGNIELSR
ILGADVRLDAAGFDIGIRPSWEQAMEDVRRAGGKPFPIPAGCSEHPLGGLGFVGFAEEVR
QQEAEFGFRFDYIVVCSVTGSTQAGMVVGFAADGRADRVIGIDASAKPEQTREQILRIAR
DTAKLVELGRDITEDDVVLDTRYGGPEYGLPNEGTLEAIRLCARQEGMLTDPVYEGKSMH
GMIDRVRGGEFPEGSRVLYAHLGGVPALNAYSFLFRNG
 
last changed 2005/03/16 20:05

B6db sequences