Activities | Families | Sequences | Fold types | References | Help
B6db sequences: cad31372.1

CAD31372.1

Description PROBABLE PYRIDOXAL-PHOSPHATE-DEPENDENT AMINOTRANSFERASE NITROGEN FIXATION NIFS PROTEIN [Mesorhizobium loti]
Activity 2.8.1.7
Family 2.8.1.7.a
Evidence ISS - similarity
Phylum Bacteria
OS Mesorhizobium loti
GB CAD31372.1
SQ
MRPVYLDNNATTRVDPEVVQAVLPFFTDQFGNPSSSHDFGASAGAAVRKARLRVQTLIGA
EFEDEITFTSGGTESDNAAILSALEVMPERTEIVTSAVEHSAVLTLCAHLEKTRGIKVHR
IPVDRHGRLDLDTYKAALTPRVAIVSIMSANNETGTIFPVVELAELAKEVGALFHTDAVQ
AVGKLAIDLKSTAIDMLSLSGHKLHGPKGVGALYVKRGVRFCPLIKGGGQEGNRRAGTEN
TPGIVGLGVAADLALKFMDDANTRVKALRDRLEKELLQRIPHAFVAGDLLKRLPNTANIA
FGDIEGEGILHFLNREGIACSSGSACACGSLEPSHVLVAMNIPNSAAHGAIRFSFSRNNG
EEDVDRVLEVMPGIVKKLRELSPSASQARGLQSAPGLGDKANPTTVSGPGECNAQLFR
 
last changed 2005/03/16 20:05

B6db sequences