Activities | Families | Sequences | Fold types | References | Help
B6db sequences: cae43424

CAE43424

Description omega-amino acid--pyruvate aminotransferase
Activity 2.6.1.18
Family 2.6.1.18
Evidence ISS - similarity
Phylum Bacteria
OS Bordetella pertussis
GB CAE43424
SQ
MNAPASPPDLSHLWMPFTANRQFKSQPRLLARAEGMYYTSTDGRQILDGTAGLWCVNAGH
CRPEIVQAIASQAGEMDYAPGFQLGHPLAFEAATAVASFMPAGIDRVFFTNSGSESVDTA
LKIALAYHRARGDAQRTRLVGRERGYHGVGFGGISVGGISANLKTFSGALLPAVDHLPHT
HSLKHNAFSKGQPAWGEHLADELERIVALHDASTIAAVIVEPMAGSTGVLVPPKGYLQRL
REITARHGILLIFDEVITAYGRLGSPTAAEHFGVTPDIITMAKGVSNAAVPAGAVAVKRE
VHDAIVNGVQGGIEFFHGYTYSAHPLAAAAILATLGIYRRDDLFGRARDLSPAFEKAAHA
LQGAPHVIDVRNIGLVAGIELASRPDAPGARAAEAFRKCFDSGLMVRYTGDILAVSPPLI
IDEAQIGELFEGIGKVLKEIA
 
last changed 2005/03/16 20:05

B6db sequences