Activities | Families | Sequences | Fold types | References | Help
B6db sequences: cae63230

CAE63230

Description Hypothetical protein
Activity 2.6.1.5
Family 2.6.1.5
Evidence ISS - similarity
Phylum Metazoa
OS Caenorhabditis briggsae
GB CAE63230
SQ
MQTLMSHSHSRVAPLPGAITKEEIKNQLMVHERRFLSKPTRKEEWTVLPQSAHSKNTVNP
VRRIADACAVPPNPEKKVIRLHLGDPSVGGKLPPSEVAVQAMHESVSTHMYDGYGPAVGA
LAARQAIVDRYSSSDNVFTADDVVLASGCSHALQMAIEAVANAGDNILVPHPGFPLYSTL
CRPHNIVDKPYKIDMTGEDVKIDLSYMATIIDENTRAIIVNNPGNPTGGVFTKEHLKEIL
EFANKYKLIIIADEIYGDLVYNGATFYPMASLSPKVPIITCDGIAKRWMVPGWRLGWLII
HNHFGVLNEVKQGIVALSQKIVGPCSLVQGALPKILRETPEEYFVYTRNVIETNANIVGN
ILADVPGMRVVKPKGAMYMMVNISRSAYGNDVNFCQNLIQEESVFCLPGQAFSAPGYFRV
VLTSSTDDMEEAATRIRDFCFRNINQFSDSEDSSDEGLDLSAMESD
 
last changed 2005/03/16 20:05

B6db sequences