Activities | Families | Sequences | Fold types | References | Help
B6db sequences: cae67402

CAE67402

Description Hypothetical protein CBG12888
Activity 2.6.1.44
Family 2.6.1.44.a
Evidence ISS - similarity
Phylum Metazoa
OS Caenorhabditis briggsae
GB CAE67402
SQ
MQRVQQLRPLLPKGHVTYYKDQLLIVKGEKQFLFDSNGKKYLDFFGGIVTVSVGHCHPKV
NAALTEQSKKLWHTTSIYHTEPIYEYAQKLLGKFPSKLNTVFFVNSGSEANDLALALARN
YTGRFDVISMRNGYHGMTQTVLGATNLGNWKPVFPHGFNIFKSLNADPYRGIFGGSNCRD
SPIQVKNRRCGCAPGVCEASEKYVEQFEEMLLHDFSHSSGPAAFLIESIQGVGGTVQYPH
GYLKKSYEAVQKRGGIAIADEVQTGFGRLGSHFWGFESQDAMPDMVTMAKGIGNGFPLGA
VVTTKEIADSFNKSLYFNTYGGNPLASVVGKAVLEVIEEEKLQENCAVVGDYFLKQLAAL
DEKAIGDVRGKGLMIGVELIDEQGKPLAAAKTAAIFEDTKNHGLLIGKGGIHGNVLRIKP
PMCITKQDVDFAVDIIAKSIKQFK
 
last changed 2005/03/16 20:04

B6db sequences