Activities | Families | Sequences | Fold types | References | Help
B6db sequences: caf91636

CAF91636

Description unnamed protein product
Activity 4.3.1.17
Family 4.3.1.17a
Evidence ISS - similarity
Phylum Metazoa
OS Tetraodon nigroviridis
GB CAF91636
SQ
MQSQQSLHVATPLRQSLPLTKEAGTSVYLKLDSSQPTGSFKIRGIGHLCKTWAERGCERL
VCCSGGNAGMAAAYSARQLGVPATIVVPSVTPVMTVERLRDEGATALNESIEYGKQLVAN
NPGWIFISPFDDPLIWEGHTSLVKELEQELRETPGAIALSVGGGGLLNGVVEGLRRAGWG
DVPIVAMETLGAHSLNAAMEAGELVTLPEITSVATTLGLARVSAQTLKLVKEHAVFSEVV
TDQEAVKAVERFVDDEKILVEPACGAALAAVYSGVLKKLQCEGKLAKQMGGPVVIVVCGG
NNISFGQLQKLKKQLGLSNA
 
last changed 2014/03/05 15:23

B6db sequences