Activities | Families | Sequences | Fold types | References | Help
B6db sequences: caf97143

CAF97143

Description unnamed protein product
Activity 2.6.1.44
Family 2.6.1.44.a
Evidence ISS - similarity
Phylum Metazoa
OS Tetraodon nigroviridis
GB CAF97143
SQ
PEMPPCDFKPEEFKGMSKERMLEIRQRNCFPMTMKVTYYKNPVFIHQGHMQWLWDVDGKR
YLDLFAGVATVSVGHSHPRVTAAAERQLKRLWHTTNIYVHPTLHEYCEKLASHLPDPLKV
VYLTNSGSEANDLAVMLARLHTGNFDVITFRGSYHGGSPQSTGLVSNQIYKYPVATSLGC
TNTMCPDVFRGVWGGRHCRDSPVQTIRECSCSQGQCMAKDQYVSQLRETFATSVPSRIAA
FFAEPIQGVGGAVQYPKNYLKEAFELVRERGGLCIADEVQTGFGRTGSHMWGFQGHGVIP
DIVTMAKGIANGFPMGAIVTTPEIAASFNKAVHFNTFGGNPVAGAIASSVLDTVREDGLQ
QNSLDVGTHLMTELAKLRDKYEIVGDVRGKGLMIGVEMVKDKTSRDPLAPELMNEIFEDL
KNMGVLIGKGGIYGQTFRIKPPMCVTMDDADFFVAVFNKALHNCMEKIVK
 
last changed 2005/03/16 20:05

B6db sequences