Activities | Families | Sequences | Fold types | References | Help
B6db sequences: can72828

CAN72828

Description hypothetical protein
Activity 2.6.1.5
Family 2.6.1.5
Evidence ISS - similarity
Phylum Viridiplantae
OS Vitis vinifera
GB CAN72828
SQ
METGTKKWGFEDAENGPDTTTTITIKGLISLLMANIDEGNNKRLISLGMGDPSVYTCFHT
SHVATESVVDAVESNKYNGYAPTSGLPQARKAIAEYLSRDLPYKLSLDDVFITSGCTQAI
DVALSILARPGANILIPNPGFPIYQLSASFRGLEVRYYDLLPEKGWEADLDAIKALADQN
TVALVIINPNNPCGSVYSYQHLKKTAETARKLSIPVIADEVYGHLAFGGNPFVPMGVFGS
IVPVLTLGSLSKRWIVPGWRLGWFVITDPSCLFITPKIVERLKKYFDILGGPATFIQAAV
PRIMEQTDGTFFKKTINILKQASDICLEKIQEIPCITCPHKPEGSMAVMVKLNLSLLEDI
NDDIDFCFKLAKEESVIILPGVAVGLKNWLRITFAADPSFLEEGLERIKSFYHRHSNIQH
SN
 
last changed 2014/03/04 12:31

B6db sequences