Activities | Families | Sequences | Fold types | References | Help
B6db sequences: eaa28795.1

EAA28795.1

Description hypothetical protein [Neurospora crassa]
Activity 2.6.1.39
Family 2.6.1.39.a
Evidence ISS - similarity
Phylum Fungi
OS Neurospora crassa
GB EAA28795.1
SQ
MGEALINGSGAVSNVSALETLGPAAKLTDADPSEIPPASGPGRENAVTISDILERRAKAG
RLIAPTASYADSDMFKGPQVGKPKSKSMNHHLSAESLSRHPCALKQAARHLKNPNIISLG
GGLPCAEYFPIESITLKVPTPPDFSEAATSQSGAEVRIGKYDATDPSIQGTYDLAVALNY
AQASGSAQLLRFVTEHTELVHNPPYSDWRSCLTIGSTGALEQTLRMLCDGPGRRDSLLTE
EYSFSTALETAGPLDLKVVGVKMDGQGLLPEAMDELLSNWNPEEREGRRKPHVLYTVPSG
QNPTGTTQGLERRKQVYEVARKHDLFVIEDEPYYYLQMPLEESKETESEEETVESFMSSL
IPSLLSLDVDGRVLRMDSFSKVVVPGSRVGWVTASENIIEQYLRHAEVCNQGANGISQVI
LYKLLDEQWGHEGYFKWLMNLRQEYTKRRDTMVTAAEKFLPKEVVSWTVPVAGMFYWLKI
DHSQHPGIQAGKGILEVEEEIFNSCIARGVLVARGSWFRAEQDTEPNELFFRATFAAATA
ENMTEAIRRFGEAIRESFKL
 
last changed 2007/11/19 15:00

B6db sequences