Activities | Families | Sequences | Fold types | References | Help
B6db sequences: eaa46698.1

EAA46698.1

Description hypothetical protein MG09919.4
Activity 2.6.1.39
Family 2.6.1.39.a
Evidence ISS - similarity
Phylum Fungi
OS Magnaporthe grisea
GB EAA46698.1
SQ
MSTSTQVRTSSAIKIMSPTLLAIDESAAAAETVGPIGLPAKQVPEHPNSVAARAPKLERP
RRITFKDIADKRTRAGKLVALTASASDSDMFKVAAAGQKPKARRWDHLLSQESASRKPCR
LKQAALNLRKPGIISLGGGLPCPDNFPIESISMRVPSVSGGFSEADTRAHGLDVTVGKYD
VQEQAEDPNGAVYDLSIALNYSQATGSAQMMRFVTEHTELVNNPPYADWRCSMSIGSTGA
LEMALRIFCDRARNDSMLTEEFSFSTAVETAMPLGIKVFGVPVDGEGLIPEKMDEILRTW
KPEERKGAAKPHVLYTVPSGQNPTGSTQSEERRRALYQVCREHDVYIIEDEPYYYIQMPP
YRGRDAKKEEEQSNDAEETPEQFLESLVPSILSMDVDGRVLRMDSFSKVVVPGSRMGWVT
ASEQIIDRFIRHGESCNQGPSGIAQVLLHKLLDETWGHEGYIRWLMSVRGEYTRRRDVLL
AACEDHLPREVVNWEVPKTGMFHWLKVDHTKHPCASTMSISEMEAEIFKDCIDKGVLVAA
GSWFMADHDAEPSGLFFRATFAAATPDNMIEATRRLGDAIRSSFQLN
 
last changed 2007/11/19 15:00

B6db sequences