Activities | Families | Sequences | Fold types | References | Help
B6db sequences: eaa47569

EAA47569

Description hypothetical protein
Activity 3.5.99.7
Family 3.5.99.7
Evidence ISS - similarity
Phylum Fungi
OS Magnaporthe grisea
GB EAA47569
SQ
MSTNDIKLPEPFASIPRETFLFGPSPIQHLERISEALGGKVNVYAKRDDCNSGLAYGGNK
TRKLEYLAAEAKAQGADTLVSIGGVQSNHTRQVAAVSTKLGLKAVLVQEHWVPDWSDPVY
GKVGNIQLSRLMGADVKLDPSGFGIEHKNSLAAAVAELQSQGRRPYAIPAGASDHPLGGL
GFARWAFEVEEQERQMGVFFDTVIVCAVTGSTMAGMVAGFKLAQKKCGSKPRRVIGIDAS
ATVPQTKEQVLRIAQVTGRKIGLEDGVDNVTTEDVELDDRYHAGIYGVPDQQTKDAIRFG
ASTEAFITDPVYEGKSLAGMMDMIRKGEIKPGSNVLYAHLGGQLALNAYSDIFIVHRRQS
SLGNPMANPWPKHAMHLAEYSPANTWWWSKATMCGCKKHTL
 
last changed 2005/03/16 20:04

B6db sequences