Activities | Families | Sequences | Fold types | References | Help
B6db sequences: eaa50300

EAA50300

Description hypothetical protein
Activity 2.6.1.52
Family 2.6.1.52
Evidence ISS - similarity
Phylum Fungi
OS Magnaporthe grisea
GB EAA50300
SQ
MPTRADITYFGAGPAALPTDVLEKAAQALLDYNGTGLGIAEHSHRSEHATTIINEAKADL
LAYLDVPEAADYDVLFMQGGGSGEFAATVYNLVGAWVARQVKAAGLEGEKDDAKVAEALR
PKLQYLKLDYIVTGGWSLKAYQEAQRLVGPEHVNLVADSRPANGGKFGTIPPESEWKLSK
DAAMVYYCDNETVDGVEFPKFPDILATSGGEGPLVVADMSSNILSRRIPVKNYGVLFFGA
QKNLGSTGVTVAVVKKSLLPPTTPQPSATLLRKLGLPVGPIILSYETIAKNNSLYNTLSI
FDVYIAGLVLKKLLATYPADKVDGQQAVADKKAKLIYAALDAHPEVFRVVPAKSARSRMN
ICFRVTKGGEANTDAAEKEFLKQATALNLTGLKGHRSVGGIRASNYNSIPLEGAEKLARF
IEDFAKA
 
last changed 2005/03/16 20:05

B6db sequences