Activities | Families | Sequences | Fold types | References | Help
B6db sequences: eaa64113

EAA64113

Description hypothetical protein
Activity 3.5.99.7
Family 3.5.99.7
Evidence ISS - similarity
Phylum Fungi
OS Aspergillus nidulans
GB EAA64113
SQ
MPSQDVPLPEPFASVPRETLTFGPSPIQYLPNITAALGGKVNIYAKREDVNSGLAFGGNK
TRKLEYLASDALAQKADTLVSIGGFQSNHTRQVAAVARKLGLEVALVQEKWVDWDDKNGV
YDKAGNIQLSRLMGADTRLDMSGFGIEHKLTLKNLEEEIRARGGKPYYIPAGASDHPLGG
LGFARWAFEVEMQEKELGVFFDTVIVCAVTGSTMAGMIAGFKLAQKVNGSRKRKIIGIDA
SATVEQTFEQILRIAKFTGVKIGLDEEDITAEDVILDDRYHAGVYGIPDEATIEAIKFGA
RTEAFITDPVYEGKSLNGMMDMGLLSCCRIVFRVKS
 
last changed 2005/03/16 20:06

B6db sequences