Activities | Families | Sequences | Fold types | References | Help
B6db sequences: eaa64669

EAA64669

Description hypothetical protein
Activity 4.4.1.14
Family 4.4.1.14
Evidence ISS - similarity
Phylum Fungi
OS Aspergillus nidulans
GB EAA64669
SQ
MTSHTFIERQETMLGPSASTLSRRARSSLKCTSNALWDVLNDIWHPQSNPHGYVTLGVAD
NTLMQQQLLFRANSSFEMSGQHLALNDTITGSPRLKAAIADILSRYLHPSKLLRPSHILA
TNGVASAIEHCSWALCDPGDGILVGRPYFRGFSRDICLRPAARLVQVSFEGVDPLGISAV
SIYEEALINSSKQGCAIRAIMICNPHNPLGRCYSQSFLIEIMKLCQRFGVHLISDEIYAL
SVWREGQDGAVSMNKFTSVLSIDHDGLIDPSLVHVLWGVSKDFGANGMRLGAVISQGNSD
MLESIRGVAQYSSVSGLADCFTTNILEDERFVNQFIAENNKALAATYEYVVAFMDRHGIP
YARGSNAGFFVWCDLLTPYLKLQPASSFDGSEKAKAIKNRELLDKLSRFKVHLGVGDDFG
SEQKGWFRITFSQSQEQLDEGLARIIDALRY
 
last changed 2005/03/16 20:04

B6db sequences