Activities | Families | Sequences | Fold types | References | Help
B6db sequences: eak97061

EAK97061

Description hypothetical protein
Activity 4.3.1.17
Family 4.3.1.17a
Evidence ISS - similarity
Phylum Fungi
OS Candida albicans
GB EAK97061
SQ
MKEPSITTTFVEVTDKLPTKPPCRVFFKNEYEQPSGSFKLRGMGHLVGQSIDVARKLGKS
NVAVFSSSGGNAGLAAAYASQFFGVSCTVVLPESSKPTVIEKLKSLGADVIIHGKHWGEA
DNYLTDFVIKNLDKTVYPVYCHPFDDPLLWEGHSKIITEIIDQKQLPNFDKVKGVICSVG
GGGLYNGIVEGLENHKEIPVLAIETKQAATFHEAVKEGKVVHLQKVQTLATSLASPYLSS
KALANYIERPTVLAEIDDLDAVKGVVDVYDHFGYMVEPACGASVASVMHRQDLLNKFGTL
SPDDIIIVVICGGSAINKYIIDEYRSLLEKDS
 
last changed 2014/03/05 15:21

B6db sequences