Activities | Families | Sequences | Fold types | References | Help
B6db sequences: edq75781

EDQ75781

Description minotransferases class-I pyridoxal-phosphate-binding site
Activity 2.6.1.83
Family 2.6.1.83.a
Evidence ISS - similarity
Phylum Viridiplantae
OS Physcomitrella patens
GB EDQ75781
SQ
MSIPSARLCTVPATRNLSSSVSFSTATSLLPKVSVTRGASVSLIRCIAEPAEKTTYTTSV
NRNANIAKLQAGYLFPEIARRRNAHIQRYPDAKVISLGIGDTTEPIPTVITGAMEARARA
LSTLEGYSGYGAEQGEKPLRAGIGAAFYADLGIDETEIFVSDGAKCDITRLQLVFGPNVT
MAAQDPSYPAYVDTSVMMGQTGLFQSDSQQYSKIQYMKCTPENDFFPDLSSTPRTDIIFF
CSPNNPTGASASRKQLEELVAFAKKNGSIIVYDSAYAIYTSDDSPKSIYEIPGAKECAIE
TASFSKYAGFTGVRLGWTVVPKALKFADGHPVHTDFNRVMTTCFNGASNVAQAGGLACVS
SEGLKAMHETVKFYKENTKILVETFESLGFKTFGGKNAPYVWVQFPGKSSWDVFSEILEQ
THIVTTPGSGFGPGGEGFIRASAFGHRENILEASRRLKEYFGSKK
 
last changed 2010/12/06 15:51

B6db sequences