Activities | Families | Sequences | Fold types | References | Help
B6db sequences: eeq18236

EEQ18236

Description purine catabolism protein
Activity pucg
Family pucg
Evidence ISS - similarity
Phylum Bacteria
OS Yersinia ntermedia
GB EEQ18236
SQ
MNPNPLFCQINPPARLLMGPGPINADPRVLRAMASQLIGQYDPVMTEYMNQVMALYRGVF
RTENRWTMLIDGTSRAGIEAVLLSAIRPGDKVLVPVFGRFGHLLCEIARRCRAEVHTIEV
PWGEVFSPQRIEDAIKKVRPRLLLTVQGDTSTTMLQPLAELGEICRRHHVLFYTDATASL
GGNVLETDAWGLDAVSAGLQKCLGGPSGSAPVTLSPQFAEQVRRRKCIEQGIRTQDHADG
DEEMIYSNYFDLGMIMDYWGPERLNHHTEATSMLFAARECARVMLEEGLDNGIARHALHG
SALLAGIQGMGLAVFGDIGHRMNNVLGVVIPAGIHGEQVRQLMLNDFGIEIGTSFGPLNG
KIWRIGTMGYNARKDCVLQTLVALEAVLNRLGFATVQGNGLQSAWNVYQAESDKQAIDTV
NGAK
 
last changed 2010/06/17 13:26

B6db sequences