Activities | Families | Sequences | Fold types | References | Help
B6db sequences: eff86107

EFF86107

Description 2,3-diaminopropionate biosynthesis protein SbnA
Activity sbna
Family sbna
Evidence ISS - similarity
Phylum Bacteria
OS Acinetobacter sp. SH024
GB EFF86107
SQ
MIHENILDCIGKTPLLQLSRLFTHQSISVIAKMELLNPGGSIKDRPALFMLQEGLKSGVI
NKDSHIVESSSGNLAIALAMACKIYGLKFTAVIDPKIASANLQMLKLYKANIEMVSEKDQ
NGGYLKTRIDTVKRLCQQLPNAVWINQYANPNNWKSHYFGEAEEILNQIDRKIDYLVIGA
STSGTIMGVSRRLKERFPELKVIAVDIVGSVLFGGTSGPREIPGIGASTVPPLLSPDEID
DVIYVDDYESALGCRELLEHEGIFAGGSSGSSISAIKKLIPTIPDGSCVLTLLPDRGDRY
LDLVYEDEWFEMIKKRHFNRNVRRQENLTLQNAV
 
last changed 2014/07/04 15:16

B6db sequences