Activities | Families | Sequences | Fold types | References | Help
B6db sequences: esw05165

ESW05165

Description hypothetical protein
Activity 2.6.1.5
Family 2.6.1.5
Evidence ISS - similarity
Phylum Viridiplantae
OS Phaseolus vulgaris
GB ESW05165
SQ
METGAVAMNNNNNIVNHHHEARATSTITIKGMLSLLMENIDENLDGGTKKVISLGMGDPT
LTTLFHAPKVVEEAVADSLHSHKFNGYAPTAGLLQARIAIAEYLSRDLPYQLSSDDVFIT
SGCTQAIDVSVAMLARPGANILLPRPGFPIYELSAAFRGIEVRHYDLLPEKGWEVDLDAV
EASADQNTAALVIINPGNPCGNVYSYHHLEKIAETAKRVGTIVISDEVYGHLAFGAKPFV
PMGVFGSVVPVLTLGSLSKRWIVPGWRLGWFVTNDPSGTFREPKVVERIKKYFDLLGGPA
TFIQAAVPQIIANTEEIFFNKTIDNLRHTADICCTEIKDIPCIFCPYRPEGSMAMMVKLN
LSLLEDISDDIDFCFKLAKEESVIILPGTAVGLKDWLRITFAADPCALGEGMRRMKSFCQ
RHVRKL
 
last changed 2014/03/04 12:34

B6db sequences