Activities | Families | Sequences | Fold types | References | Help
B6db sequences: gaj41681

GAJ41681

Description Siderophore biosynthesis protein SbnA
Activity sbna
Family sbna
Evidence ISS - similarity
Phylum Bacteria
OS Geobacillus caldoxylosilyticus
GB GAJ41681
SQ
MLHNVAAEIGHNMLRQSVIECIGNTPLVSLNRLFPPKEVQVFAKLEYMNPGGSMKDRPAR
FIIEQGLKAGTITPDTHIVESTSGNLGIALAMVARVYNLQLTCVVDPKISPANLNILKQF
GANVVMVTEKDEHGGYLKTRIQKVKEIIQENPKTLWINQYANENNWRAHYYGAGSELVDQ
LPDGIDYFVAPVSTTGSIMGISRRLRERFPKLKVIAVDAVGSIIFNAPPANREIPGIGAS
RVPEILNRDEIDDVIYVNDYESAIGCRKLLQTEGIFAGGSSGSVVAAIEKLIPHLHHTKL
VTIFPDRGDRYLDLVYNDEWLSRLKKKN
 
last changed 2014/07/04 15:13

B6db sequences