Activities | Families | Sequences | Fold types | References | Help
B6db sequences: np.001028922

NP_001028922

Description hypothetical protein LOC619269
Activity 2.6.1.44
Family 2.6.1.44.a
Evidence ISS - similarity
Phylum Metazoa
OS Danio rerio
GB NP_001028922
SQ
MHKVCCRLHGRSLLGKTGLRSSVDACVKFHKAGGVLCQKTAVKHPSAVLPQIPPRDFKPE
PYQGMSKERLLDIRKHNCNPMTMKVTYYKKPVFINQGHMQWLWDVDGRRYLDLFAGVATV
SVGHCNPKVTEAAEKQLRRLWHTTPIYVYPQIQEYAEKLVSLLPDPLKVVYFTNSGSEAN
DLAVLMARLHTGNFDAITLRGSYHGGSPQATGLMSNTHYKYPVPSSLGCHNTMCPDVFRG
LWGGSHCRDSPVQTIRECSCSPGHCYANDMYIKELKEVFDTTVPSRIAAFFTEPIQGVGG
AVQYPKNYLKETYQLVREKGGICIADEVQTGFGRTGSHFWGFEGHNVIPDMVTMAKGIAN
GIPMGAVVTTAEIARSFAKGVHFNTFGGNPLACAIASSVLDTIKEDKMQENSAELGTYLL
TELAKLRDKYEIIGDVRGKGLQIGVEMVKDKASRTPLPQEAMNEIFEDTKDMGVLIGKGG
LYGQTFRIKPPMCITKADADFFLSVFNQAVLNYTERR
 
last changed 2008/01/28 18:31

B6db sequences