Activities | Families | Sequences | Fold types | References | Help
B6db sequences: np.001091171

NP_001091171

Description unnamed protein product
Activity 4.3.1.17
Family 4.3.1.17a
Evidence ISS - similarity
Phylum Metazoa
OS Xenopus laevis
GB NP_001091171
SQ
MPENKCLHLNTPLRDSVPLSKMAGMTVYLKLDNAQPTGSFKIRGIGHLCKTWAERGCKHF
VCSSGGNAGLAAAYSARMLSIPATILVPNTTPAFTIQRMKDEGATVCVVGEMLDETIEHG
KELVRNNPGWVYIPPFDDPLIWEGHTSLVKEIKASLPSKPGAIALSVGGGGMLCGVVQGL
REEGWDDVPIIAMETKGAHSLNAALQAGKLVTLPEITSVAKTLGAKTVGAQTLKVAQEHS
VFSEVISDQEAVMAIEKFADDEKMLVEPACGAALAAVYSNVAERLKKEGKLSPDLSSLVI
IVCGGNNITLAQLFQLKKQLGMLSDSSA
 
last changed 2014/03/05 15:22

B6db sequences