Activities | Families | Sequences | Fold types | References | Help
B6db sequences: np.001246025

NP_001246025

Description black, isoform B
Activity 4.1.1.29
Family 4.1.1.29
Evidence IDA - direct assay
Phylum Metazoa
OS Drosophila melanogaster
GB NP_001246025
SQ
MLASENFPTHHFKESIFKPYSTTSGDDLASVSPLTATAALVASTSSPADSTSTVAFEQAS
KMLANAANNNNNNNNNITSTKDDLSSFVASHPAAEFEGFIRACVDEIIKLAVFQGTNRSS
KVVEWHEPAELRQLFDFQLREQGESQDKLRELLRETIRFSVKTGHPYFINQLYSGVDPYA
LVGQWLTDALNPSVYTYEVAPLFTLMEEQVLAEMRRIVGFPNGGQGDGIFCPGGSIANGY
AISCARYRHSPESKKNGLFNAKPLIIFTSEDAHYSVEKLAMFMGFGSDHVRKIATNEVGK
MRLSDLEKQVKLCLENGWQPLMVSATAGTTVLGAFDDLAGISEVCKKYNMWMHVDAAWGG
GALMSKKYRHLLNGIERADSVTWNPHKLLAASQQCSTFLTRHQQVLAQCHSTNATYLFQK
DKFYDTSFDTGDKHIQCGRRADVFKFWFMWKAKGTQGLEAHVEKVFRMAEFFTAKVRERP
GFELVLESPECTNISFWYVPPGLREMERNREFYDRLHKVAPKVKEGMIKKGSMMITYQPL
RQLPNFFRLVLQNSCLEESDMVYFLDEIESLAQNL
 
last changed 2014/02/26 12:05

B6db sequences