Activities | Families | Sequences | Fold types | References | Help
B6db sequences: np.142859

NP_142859

Description hypothetical protein PH0937
Activity 4.1.1.25
Family 4.1.1.25.b
Evidence ISS - similarity
Phylum Archaea
OS Pyrococcus horikoshii
GB NP_142859
SQ
MKFPRIGLPKEKVIELINEKTKKDLTFSSGKILGSMCTMPHDLAIEVYTKYIDRNLGDPG
LHPGTRKIEEEVIEMISDLLHLEKGHGHIVSGGTEANILAVRAFRNLSDVEKPELILPKS
AHFSFIKAGEMLGVKLVWAELNPDYTVDVRDVEAKISDNTIGIVGIAGTTGLGVVDDIPA
LSDLARDYGIPLHVDAAFGGFVIPFAKELGYELPDFDFKLKGVQSITIDPHKMGMAPIPA
GGIVFRRKKYLKAISVLAPYLAGGKVWQATITGTRPGASVIAVWALIKHLGFEGYMRIVE
RAMKLSRWFAEEIKKINNAWLVREPMLNIVSFQTKNLKKVERELKSRGWGISAHRGYIRI
VFMPHVTREMIEEFLKDLKEVLS
 
last changed 2005/04/12 13:15

B6db sequences