Activities | Families | Sequences | Fold types | References | Help
B6db sequences: np.199430

NP_199430

Description ornithine aminotransferase; protein id: At5g46180.1
Activity 2.6.1.13
Family 2.6.1.13
Evidence IDA - direct assay
Phylum Viridiplantae
OS Arabidopsis thaliana
GB NP_199430
SQ
MAATTRRLLYYVSKRFSTAGVRRSYGGLPQSNSKSPPSSSQRLMELESEFSAHNYHPVPV
VFSRANGSTIWDPEGKRYIDFLAAYSAVNQGHCHPKIMKALQEQVEKLTLSSRAFYNDKF
PVFAERLTNMFGYDMVLPMNTGAEGVETALKLARKWGHEKKNIPKDEAIIVSCCGCFHGR
TLAIVSMSCDNDATRGFGPLLPGNLKVDFGDADSLEKIFKEKGDRIAGFLFEPIQGEAGV
IIPPDGYLKAVRELCTKYNVLMIADEVQSGLARSGKMLACDWEEIRPDMVILGKALGGGV
IPVSAVLADKDVMLHIKPGQHGSTFGGNPLASAVAMASLDVIVEEKLVERSASLGEELRI
QLNEIKKQFPKYIKEVRGRGLFNAIEFNSESLSPVSAYDICLSLKERGVLAKPTHNTIVR
LTPPLSISSDELRDGSEALHDVLELDLPNLLKINSGKTPVSHITECDRCGRNLYA
 
last changed 2008/04/24 18:48

B6db sequences