Activities | Families | Sequences | Fold types | References | Help
B6db sequences: np.216726

NP_216726

Description branched-chain amino acid aminotransferase
Activity 2.6.1.42
Family 2.6.1.42
Evidence IDA - direct assay
Phylum Bacteria
OS Mycobacterium tuberculosis H37Rv
GB NP_216726
SQ
MTSGSLQFTVLRAVNPATDAQRESMLREPGFGKYHTDHMVSIDYAEGRGWHNARVIPYGP
IELDPSAIVLHYAQEVFEGLKAYRWADGSIVSFRADANAARLRSSARRLAIPELPDAVFI
ESLRQLIAVDKAWVPGAGGEEALYLRPFIFATEPGLGVRPATQYRYLLIASPAGAYFKGG
IAPVSVWVSTEYVRACPGGTGAAKFGGNYAASLLAQAEAAENGCDQVVWLDAVERRYIEE
MGGMNIFFVLGSGGSARLVTPELSGSLLPGITRDSLLQLAIDAGFAVEERRIDIDEWQKK
AAAGEITEVFACGTAAVITPVARVRHGASEFRIADGQPGEVTMALRDTLTGIQRGTFADT
HGWMARLG
 
last changed 2007/11/19 18:54

B6db sequences