Activities | Families | Sequences | Fold types | References | Help
B6db sequences: np.360367.1

NP_360367.1

Description nifs protein homolog [Rickettsia conorii]
Activity 2.8.1.7
Family 2.8.1.7.a
Evidence ISS - similarity
Phylum Bacteria
OS Rickettsia conorii
GB NP_360367.1
SQ
MNPQLNNLTLPIYMDYQATTPIDPRVMEAMLPYFTTKFGNPHSRSHSFGWEAENAVEEAR
SMVAKLIGADTKEIIFTSGATESNNLAIKGIAKFYSNKKNHIITVVSEHKCVLDACRHLE
QEGIKITYLPIKPNGIIDLETLKNAITDQTMLVSVMVVNNEIGVVQPLKEIGKICREKGV
FFHSDIAQGFGKIPIDVNAFNIDLASISGHKIYGPKGIGALYVRKKPRVRVTPLINGGGQ
ERGMRSGTLPTPLIVGLGMAAEIAYSEMEKDTKHVNYLFDRFLNNIHKRISEVYLNGDKN
QRYKGNLNLSFAGVEGESMILAIKDLAVSSGSACTSASLEPSYVLRSMGIGEELAHTAIR
FGIGRFTTEQEVDYAVNLICSKIDKLRELSPLWEMMQEGIDLKKIKWAVH
 
last changed 2005/03/16 20:04

B6db sequences