Activities | Families | Sequences | Fold types | References | Help
B6db sequences: np.385354.1

NP_385354.1

Description PUTATIVE O-ACETYLHOMOSERINE SULFHYDRYLASE PROTEIN [Sinorhizobium meliloti]
Activity 2.5.1.49
Family 2.5.1.49
Evidence ISS - similarity
Phylum Bacteria
OS Sinorhizobium meliloti
GB NP_385354.1
SQ
MKAGPGFSTLAIHAGAQPDPTTGARATPIYQTTSFVFNDTDHAAALFGLQQFGNIYTRIM
NPTQAVLEERIAALEGGTAGLAVSSGHAAQLLVFHTIMRPGDNFVSARQLYGGSANQFGH
AFKAFDWQVRWADSAEPESFDAQIDERTKAIFIESLANPGGTFVDIAAIADVARRHGLPL
IVDNTMATPYLMRPLEHGADIVVHSLTKFIGGHGNSMGGIIVDGGTFDWSKSGKYPLLSE
PRPEYGGVVLHQAFGNFAFAIAARVLGLRDFGPAISPFNAFLIQTGVETLPLRMQRHCDN
ALEVAKWLKGHEKVSWVRYSGLEDDPNHALQKRYSPKGAGAVFTFGLAGGYEAGKRFVEA
LEMFSHLANIGDTRSLVIHPASTTHRQLTPEQQVAAGAGPDVIRLSVGIEDVADIIADLE
QALGKA
 
last changed 2005/03/16 20:04

B6db sequences