Activities | Families | Sequences | Fold types | References | Help
B6db sequences: np.519140.1

NP_519140.1

Description PROBABLE PYRIDOXAL-PHOSPHATE-DEPENDENT AMINOTRANSFERASE (NIFS PROTEIN) [Ralstonia solanacearum]
Activity 2.8.1.7
Family 2.8.1.7.a
Evidence ISS - similarity
Phylum Bacteria
OS Ralstonia solanacearum
GB NP_519140.1
SQ
MSTPHLPIYMDYSATTPVDPRVVDKMIPYLREQFGNPASRSHAFGWEAEKAVETAREQVA
ALVNADPREIVWTSGATESDNLALKGAANFYGSKGKHIITVKTEHKAVLDTARELERQGF
EVTYLDVQENGLIDIEQFKQALRPDTILASVMSVNNEIGVIQDIEQIGEICRDKGVIFHV
DAAQATGKVELDLQKLKVDLMSFSAHKTYGPKGIGALYVRRKPRIRVEAQMHGGGHERGM
RSGTLPTHQIVGMGEAFRIAREEMATENERIRMLRDRLHRGLTAMEEVYVNGDMERRVPH
NLNISFNFVEGESLIMAIKDVAVSSGSACTSASLEPSYVLRALGRNDELAHSSIRFTVGR
FTTEQEVDYVVELLKSKIGKLRDLSPLWEMYKDGVDLNSIQWAAH
 
last changed 2005/03/16 20:05

B6db sequences