Activities | Families | Sequences | Fold types | References | Help
B6db sequences: np.607111

NP_607111

Description putative branched-chain amino acid aminotransferase
Activity 2.6.1.42
Family 2.6.1.42
Evidence ISS - similarity
Phylum Bacteria
OS Streptococcus pyogenes
GB NP_607111
SQ
MTIAIDWDNLGFEYHKLPFRYISYYKNGQWDKGQLTEDATLHISESAPALHYGQQAFEGL
KAYRTKDGSIQLFRPDRNAARLQATADRLLMPQVSTEQFIDAAKQVVKANEDFVPPYGTG
ATLYLRPLLIGVGDIIGVKPAEEYIFTIFAMPVGNYFKGGLAPTNFIVSEAFDRAAPYGT
GAAKVGGNYAGSLLPGKAAKSAGFSDVIYLDPATHTKIEEVGAANFFGITANNEFVTPLS
PSILPSITKYSLLQLAEERLGMTVIEGDVPINELDKFVEAGACGTAAVISPIGGIQYKDN
LHVFYSETEVGPVTRRLYDELVGIQFGDIEAPEGWIVKVD
 
last changed 2005/03/16 20:04

B6db sequences