Activities | Families | Sequences | Fold types | References | Help
B6db sequences: np.611352.1

NP_611352.1

Description Eip55E gene product; Ecdysone-induced polypeptide 40kD; Ecdysone-induced protein 40kD [Drosophila melanogaster]
Activity 4.4.1.1
Family 4.4.1.1
Evidence ISS - similarity
Phylum Metazoa
OS Drosophila melanogaster
GB NP_611352.1
SQ
MSYRVQPSGFATKSIHSGQSPDQWKSAAVIPPISLSTTFKQDAPGEHRGYEYSRSGNPTR
NVLETCFAALDNAKYGLTFSSGLGATTAVLTMLSSGDHIIMGDDVYGGTNRLIRQVATRL
GISATFVDPTKLDLIKSSIKPETKLVWIESPTNPLVKVADIEAIAQLVHGVREDIVLAVD
NTFLTSYFQRPLELGADLVCYSLTKYMNGHTDVVMGGITMNSEKLYKSLKFLQNAVGIVP
SPFDCYQVNRSLKTLSLRMEQHQKNALKVAKYLETNPFVEKVLHPSLPSHPQHKIALKQA
YGYSGVFSFYIKGELKHSSAFLKALKVFTLAESLGGYESLAELPSIMTHASVPAEDRKTL
GITDGLVRLSVGLEDADDLIKDLEQALEIASKA
 
last changed 2005/03/16 20:05

B6db sequences