Activities | Families | Sequences | Fold types | References | Help
B6db sequences: np.715980

NP_715980

Description Probable branched-chain amino acid aminotransferase (EC 2.6.1.42)
Activity 2.6.1.42
Family 2.6.1.42
Evidence ISS - similarity
Phylum Bacteria
OS Shewanella oneidensis
GB NP_715980
SQ
MEIKYDLKPASERRTEQFKPEGNVGFGSLRTDHMFLMDYHDGEWRDPRIVPYGPFEMAPG
AMALHYGQSIFEGAKAFMHEDGEIYTFRINKNAERMNRSADIVCIPNIDEQMQIDAINAL
IDVDRLWFPMQEGACLYIRPFIFATEDRLSVSPSSRYTFCVVLSPSGAYYAAGVNKGIRL
LISKTYHRAVSGGTGASKAAGNYAASLRAGKAAAQFGASQVLYLDANNQQIEEAGAMNHF
HILKDGTVIIPTFTDTILKSITSQSIMELSELLGCEVRQETVMLDKFIADIESGEIIEAG
GFGTAAVVSAVGSYIFEDGRVVTVGNGEVGEHIQRIYKLYTDIQKGHVQGPEGWVKRVER
VAP
 
last changed 2005/03/16 20:04

B6db sequences