Activities | Families | Sequences | Fold types | References | Help
B6db sequences: np.718063

NP_718063

Description polysaccharide biosynthesis protein
Activity kdna
Family kdna
Evidence IDA - direct assay
Phylum Bacteria
OS Shewanella oneidensis MR-1
GB NP_718063
SQ
MPGFELFGPEEKQEVADVMEHGFTFRYNFDHMRNDRWKTRDMEQLLCEKMNVKHAHLLSS
GTAALQTAMMAAGIGAGDEVIVPPFTFVASVEAIFMAGAVPIFAEIDETLCLSPEGIEAV
ITPRTKAINLVHMCGSMAKMDEIKAICKKHNLVLLEDACQAIGGSYKGQALGTIGDVGCY
SFDSVKTITCGEGGAVITNNTEIYDNAHMFSDHGHDHIGKDRGAESHPIMGLNFRISEMN
AALGLAQLRKLDTIIDIQRKNKKAIKDAMASIPEVSFREIPDPEGDSAGFLSFMLPTEAR
TQEISKKLAANGVDGCFYWYVNNWHYLKNWKHIQELKAPAALPITLIADRPDYTQISVPK
SDAIMSRTISMLIKLSWTDAQIAERIENIKKAFAQ
 
last changed 2014/03/04 11:20

B6db sequences