Activities | Families | Sequences | Fold types | References | Help
B6db sequences: np.768717

NP_768717

Description rtxA-like protein
Activity dhap.transaminase
Family dhap..transaminase
Evidence ISS - similarity
Phylum Bacteria
OS Bradyrhizobium japonicum USDA 110
GB NP_768717
SQ
MRKAYARLRGDGARTAGHRRTQCRRNGLTRQRSLLTPGPLSLSLAVKSQMQLDLASRDDE
FKEVTACMRRLMLNLLGNAKDYSVVPIQGGGSFAMEAALSSFVSRADRPLVCVNGIYGER
VLQILRLWGVEALKLVKRATDPLDPQEIGEYLSRNPGVTHLCFVHCETTTGIVNPLQEIV
EEARRCGVKTIVDGMSSFGALNIDLSQRGPDVLVTSSNKCIEGPPGVAFVIASRELLENA
AQEPRSFVLDVRDQWRSLERTGEWRSTPPTHIVQATTMALKILHEESIDARRFRYEKVRD
DLIKELEGTVSPLLSPELQSPVCVAFSAPPGIVDQEGFDGLYRHLAAHNLYVYSKLHLAT
RSFRVGCIGEIQSSWIERLGCAFRSYFRSGQARSARPAPDQEAYAARVKMPAQAVGDRQL
PFSAETAVLQRVIGATR
 
last changed 2010/01/12 15:53

B6db sequences